3dprintterrain.de bewertung und analyse

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
# we use Shopify as our ecommerce platform
User-agent: *
Disallow: /admin
Disallow: /cart
Disallow: /orders
Disallow: /checkouts/
Disallow: /checkout
Disallow: /33370767404/checkouts
Disallow: /33370767404/orders
Disallow: /carts
Disallow: /account
Disallow: /collections/*sort_by*
Disallow: /*/collections/*sort_by*
Disallow: /collections/*+*
Disallow: /collections/*%2B*
Disallow: /collections/*%2b*
Disallow: /*/collections/*+*
Disallow: /*/collections/*%2B*
Disallow: /*/collections/*%2b*
Disallow: /blogs/*+*
Disallow: /blogs/*%2B*
Disallow: /blogs/*%2b*
Disallow: /*/blogs/*+*
Disallow: /*/blogs/*%2B*
Disallow: /*/blogs/*%2b*
Disallow: /*?*oseid=*
Disallow: /*preview_theme_id*
Disallow: /*preview_script_id*
Disallow: /policies/
Disallow: /*/*?*ls=*&ls=*
Disallow: /*/*?*ls%3D*%3Fls%3D*
Disallow: /*/*?*ls%3d*%3fls%3d*
Disallow: /search
Disallow: /apple-app-site-association
Sitemap: https://www.3dprintterrain.de/sitemap.xml
# Google adsbot ignores robots.txt unless specifically named!
Meta Tags
Title 3d print terrain - Najewitz Modellbau –
Description stl files for modelling and
Keywords N/A
Server Information
WebSite 3dprintterrain favicon3dprintterrain.de
Host IP 23.227.38.32
Location Canada
Verwandte Websites
Site Rank
printmycar.co 0
Mehr zu entdecken
Site
aee-intec-events.at
autoverwertung-blechmann.de
bnbdolcevita.de
bseln.com
justincorporation.com
motoren-center.de
mystylish.biz
pepperolive.com
personalformulator.com
reiterlive.de
ruemmeli.de
stimmomat.de
t20worldcup2025.com
watchrenewedheavilythefile.vip
andalusien-tour.com
3dprintterrain.de bewertung
Euro6,612
Zuletzt aktualisiert: 2025-11-30

3dprintterrain.de hat Semrush globalen Rang von 3,983,048. 3dprintterrain.de hat einen geschätzten Wert von € 6,612, basierend auf seinen geschätzten Werbeeinnahmen. 3dprintterrain.de empfängt jeden Tag ungefähr 551 einzelne Besucher. Sein Webserver befindet sich in Canada mit der IP-Adresse 23.227.38.32. Laut SiteAdvisor ist 3dprintterrain.de sicher zu besuchen.

Verkehr & Wertschätzungen
Kauf-/Verkaufswert Euro€6,612
Tägliche Werbeeinnahmen Euro€198,360
Monatlicher Anzeigenumsatz Euro€66,120
Jährliche Werbeeinnahmen Euro€4,408
Tägliche eindeutige Besucher 551
Hinweis: Alle Traffic- und Einnahmenwerte sind Schätzungen.
DNS Records
Host Type TTL Data
3dprintterrain.de. A 3600 IP: 23.227.38.32
3dprintterrain.de. NS 7200 NS Record: ns1036.ui-dns.biz.
3dprintterrain.de. NS 7200 NS Record: ns1032.ui-dns.org.
3dprintterrain.de. NS 7200 NS Record: ns1066.ui-dns.com.
3dprintterrain.de. NS 7200 NS Record: ns1049.ui-dns.de.
3dprintterrain.de. MX 3600 MX Record: 10 mx01.kundenserver.de.
3dprintterrain.de. MX 3600 MX Record: 10 mx00.kundenserver.de.
HtmlToTextCheckTime:2025-11-30
Skip to content Just added to your cart Qty: View cart ( ) Continue shopping Submit Close search Home All Shop Items WW2 Sets Medieval Arabic / Middle East America Other files Printing Licenses 6mm Figures Musket and Bayonet Search Log in Cart 0 items Home All Shop Items WW2 Sets Medieval Arabic / Middle East America Other files Printing Licenses 6mm Figures Musket and Bayonet STL - files for wargaming and modelling From ancient time to modern warfare. You will find all what you need ! Happy printing !! Sample of Medieval building Printed and painted by Carl Schdroski Blog posts Nice interpretation of my Farmbuilding from WW2 set 5 February 22, 2022 Nice. Facebook site search for Open Sights Painting Read more Figures from DLP printer November 19, 2021 Read more Printing models at 10-12mm scale? January 24, 2021 Video Read more Medieval Saint Mère Église April 17, 2020 Very nice setting printed and painted by Carl Schdroski. He used the Saint Mère Église from Normandy 1944 set and the
HTTP Headers
HTTP/1.1 301 Moved Permanently
Date: Thu, 04 Nov 2021 06:36:44 GMT
Content-Type: text/html; charset=utf-8
Connection: keep-alive
X-Sorting-Hat-PodId: 196
X-Sorting-Hat-ShopId: 33370767404
X-Storefront-Renderer-Rendered: 1
Location: https://www.3dprintterrain.de/
X-Frame-Options: DENY
Content-Security-Policy: frame-ancestors 'none';
X-ShopId: 33370767404
X-ShardId: 196
Vary: Accept
X-Shopify-Stage: production
X-Dc: gcp-us-east1,gcp-us-east1,gcp-us-east1
X-Request-ID: 1f60da92-8fb4-4909-a5bd-9746a85fccd3
X-Download-Options: noopen
X-Content-Type-Options: nosniff
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 6a8bd4683efc0603-IAD
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400, h3-28=":443"; ma=86400, h3-27=":443"; ma=86400

HTTP/2 200 
date: Thu, 04 Nov 2021 06:36:44 GMT
content-type: text/html; charset=utf-8
x-sorting-hat-podid: 196
x-sorting-hat-shopid: 33370767404
x-storefront-renderer-rendered: 1
set-cookie: secure_customer_sig=; path=/; expires=Fri, 04 Nov 2022 06:36:44 GMT; secure; HttpOnly
link: ; rel=preconnect, ; rel=preconnect; crossorigin
x-shopify-request-trackable: false
x-alternate-cache-key: cacheable:b2eeb05e95d2e2d29ed37a0ac9101386
x-cache: miss
x-frame-options: DENY
content-security-policy: block-all-mixed-content; frame-ancestors 'none'; upgrade-insecure-requests;
strict-transport-security: max-age=7889238
x-shopid: 33370767404
x-shardid: 196
vary: Accept
content-language: en
x-shopify-stage: production
x-dc: gcp-us-central1,gcp-us-central1,gcp-us-central1
x-request-id: 4728a47f-e757-4a12-9bdd-b96103c7c95f
set-cookie: localization=; path=/; expires=Thu, 18 Nov 2021 06:36:44 GMT
set-cookie: cart_currency=EUR; path=/; expires=Thu, 18 Nov 2021 06:36:44 GMT
set-cookie: _orig_referrer=; Expires=Thu, 18-Nov-21 06:36:44 GMT; Domain=3dprintterrain.de; Path=/; HttpOnly; SameSite=Lax
set-cookie: _landing_page=%2F; Expires=Thu, 18-Nov-21 06:36:44 GMT; Domain=3dprintterrain.de; Path=/; HttpOnly; SameSite=Lax
set-cookie: _y=30ac91ea-915f-42d5-99c8-ec8305eb8066; Expires=Fri, 04-Nov-22 06:36:44 GMT; Domain=3dprintterrain.de; Path=/; SameSite=Lax
set-cookie: _s=e7cc0086-5834-456c-9e38-c1521ec7af86; Expires=Thu, 04-Nov-21 07:06:44 GMT; Domain=3dprintterrain.de; Path=/; SameSite=Lax
set-cookie: _shopify_y=30ac91ea-915f-42d5-99c8-ec8305eb8066; Expires=Fri, 04-Nov-22 06:36:44 GMT; Domain=3dprintterrain.de; Path=/; SameSite=Lax
set-cookie: _shopify_s=e7cc0086-5834-456c-9e38-c1521ec7af86; Expires=Thu, 04-Nov-21 07:06:44 GMT; Domain=3dprintterrain.de; Path=/; SameSite=Lax
x-xss-protection: 1; mode=block
x-download-options: noopen
x-content-type-options: nosniff
x-permitted-cross-domain-policies: none
cf-cache-status: DYNAMIC
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
server: cloudflare
cf-ray: 6a8bd46a7dfe0c34-DFW
alt-svc: h3=":443"; ma=86400, h3-29=":443"; ma=86400, h3-28=":443"; ma=86400, h3-27=":443"; ma=86400